PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00100.1_g00035.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family bZIP
Protein Properties Length: 287aa    MW: 31619.7 Da    PI: 9.8155
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00100.1_g00035.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.81.6e-15217259547
                              CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                   bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 
                              ++++r++kNRe+A rsR+RK+a++ eLe kv  Le+eN++L+ 
  Rsa1.0_00100.1_g00035.1 217 RKQKRMIKNRESAARSRARKQAYTHELEIKVSRLEEENERLRR 259
                              689**************************************94 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1708.0E-14210260No hitNo description
SMARTSM003382.3E-12213285IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.312215260IPR004827Basic-leucine zipper domain
CDDcd147077.19E-23217271No hitNo description
SuperFamilySSF579592.13E-10217262No hitNo description
PfamPF001701.9E-12217260IPR004827Basic-leucine zipper domain
PROSITE patternPS000360220235IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009737Biological Processresponse to abscisic acid
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 287 aa     Download sequence    Send to blast
MDSQRGVVEE PRSQSLNRQG SLYSLTLDEV QTHLGSSGKA LGSMNLDELL KSVCSVEGNQ  60
PSLNGAAAAA ATQEGLSRQG SLTLPRDLSK KTVEEVWKDI QQDKNGGGSG RHERRDKQPT  120
LGEMTLEDLL LKAGVVTETV PGGSAGLEQN ITPAVTPWVQ YHQLPSMPQP QSFMPYPVAD  180
MQAMVSQSSL MGGLSDTQTP GRKRLASGEV VEKTVERKQK RMIKNRESAA RSRARKQAYT  240
HELEIKVSRL EEENERLRRQ KEVEKILPSA PPPDPKRQLR RTSSAPF
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00409DAPTransfer from AT3G56850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX1228980.0JX122898.1 Brassica napus ABA-responsive element binding factor AREB3.1 (AREB3.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006402943.10.0hypothetical protein EUTSA_v10006121mg
SwissprotQ9LES31e-178AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2
TrEMBLV4NE970.0V4NE97_EUTSA; Uncharacterized protein
STRINGBra007274.1-P1e-180(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM18842883
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56850.11e-168ABA-responsive element binding protein 3